PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr009254.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 348aa    MW: 38575.4 Da    PI: 9.1455
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr009254.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1744.4e-5491361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeel+++yL +k+++ +++  ++i++vd++k+ePw+Lp+k+k +ekewyfFs rd+ky+tg r+nrat+ gyWk+tgkdke++++ ++
  Pbr009254.1   9 LPPGFRFHPTDEELITFYLMNKINDATFTG-RAITDVDLNKCEPWELPAKAKMGEKEWYFFSLRDRKYPTGVRTNRATNIGYWKTTGKDKEIFNSvTS 105
                  79*************************999.89***************99999****************************************99899 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  el g+kktLvfy+grap+gek++Wvmheyr+
  Pbr009254.1 106 ELAGMKKTLVFYRGRAPRGEKSNWVMHEYRI 136
                  99***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-626157IPR003441NAC domain
PROSITE profilePS5100559.3159157IPR003441NAC domain
PfamPF023651.3E-2710136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MTAEPKEELP PGFRFHPTDE ELITFYLMNK INDATFTGRA ITDVDLNKCE PWELPAKAKM  60
GEKEWYFFSL RDRKYPTGVR TNRATNIGYW KTTGKDKEIF NSVTSELAGM KKTLVFYRGR  120
APRGEKSNWV MHEYRIHSKS GFRTSKDEWV ICRVFQKSAG IKKYPTNQSR AANPYNLEIG  180
QSMVPSPLMQ LGDPNHHQFP YGRNYMTSAE MAEISRVLRG GGSSSSTVNL PIQPQFNYPI  240
GGGGGGVGGG GGGFTISGLN LNLGGPASQP MLRTMPPPQL HHQGPPSMNH HPQVQDVTNT  300
AMMNGPDHQG GYGTIDMNNN NNANGGSGNR FMNMEPCVDL DNYWPAY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-52916317171NO APICAL MERISTEM PROTEIN
1ut4_B1e-52916317171NO APICAL MERISTEM PROTEIN
1ut7_A1e-52916317171NO APICAL MERISTEM PROTEIN
1ut7_B1e-52916317171NO APICAL MERISTEM PROTEIN
3swm_A1e-52916320174NAC domain-containing protein 19
3swm_B1e-52916320174NAC domain-containing protein 19
3swm_C1e-52916320174NAC domain-containing protein 19
3swm_D1e-52916320174NAC domain-containing protein 19
3swp_A1e-52916320174NAC domain-containing protein 19
3swp_B1e-52916320174NAC domain-containing protein 19
3swp_C1e-52916320174NAC domain-containing protein 19
3swp_D1e-52916320174NAC domain-containing protein 19
4dul_A1e-52916317171NAC domain-containing protein 19
4dul_B1e-52916317171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009367940.10.0PREDICTED: NAC domain-containing protein 100-like isoform X2
TrEMBLM5XQA30.0M5XQA3_PRUPE; Uncharacterized protein
STRINGVIT_04s0008g02710.t011e-161(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50733253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-106NAC domain containing protein 38